The present invention relates to methods and pharmaceutical compositions for treating kidney cancer. The inventors have shown that while elabela (it) is expressed primarily in the kidney, its expression is reduced in human kidney cancer. In an animal model of xenograft (subcutaneous or subcapsular injection), it inhibits tumor progression. In particular, the present invention relates to a method for treating kidney cancer in an individual in need thereof comprising administering to the subject a therapeutically effective amount of a polypeptide and comprising an amino acid sequence having at least 90% identity to the sequence id. : 1 (qrpvnltmrrklrkhnclqrrcmplhsrvpfp), wherein the arginine (r) residue at position 9, 10, 20 or 21 is optionally mutated.a presente invenção se refere a métodos e composições farmacêuticas para o tratamento de câncer renal. os inventores mostraram que enquanto a elabela (ela) é expressa principalmente no rim, sua expressão é reduzida no câncer renal humano. em um modelo animal de xenoenxerto (injeção subcutânea ou subcapsular), ela inibe a progressão do tumor. em particular, a presente invenção se refere a um método para tratar câncer renal num indivíduo com necessidade do mesmo compreendendo administrar ao indivíduo uma quantidade terapeuticamente eficaz de um polipeptídeo ela compreendendo uma sequência de aminoácidos possuindo pelo menos 90% de identidade com a seq id no: 1 (qrpvnltmrrklrkhnclqrrcmplhsrvpfp), em que o resíduo de arginina (r) na posição 9, 10, 20 ou 21 é opcionalmente mutado.
