1. A pharmaceutical composition comprising a complex of: a) monospecific antibody that binds to digoxigenin, and b) digoxigenin, digoxigenin conjugated with a peptide consisting of 5-60 aminokislot.2. A pharmaceutical composition according to claim 1, wherein the peptide contains from 10 to 50 aminokislot.3. A pharmaceutical composition according to claim 1, wherein the antibody according to claim. A) is a monoclonal antitelom.4. . The pharmaceutical composition according to claim 1, wherein the antibody of part a) contains a heavy chain variable domain of sequence SEQ ID NO: 37 and a light chain variable domain of sequence SEQ ID NO: 36.5. A pharmaceutical composition according to claim 1, wherein the antibody according to claim. A) is a humanized antibody or antibody cheloveka.6. . The pharmaceutical composition according to claim 5, wherein the antibody of part a) contains a heavy chain variable domain of sequence SEQ ID NO: 39 and light chain variable domain of sequence SEQ ID NO: 38.7. A pharmaceutical composition according to claim 1, characterized in that the peptide is selected from the group consisting of: Ac-IK-Pqa-RHYLNWVTRQ (N-methyl) RY (SEQ ID NO: 26) GIGAVLKVLTTGLPALISWIKRKRQQ (SEQ ID NO: 32) FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (SEQ ID NO: 33) NKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPR (SEQ ID NO: 34) iQHRYQQLGAGLKVLFKKTHRILRRLFNLAK (SEQ ID NO: 35) .8. Complex: a) monospecific antibody that binds to digoxigenin, and b) digoxigenin, digoxigenin conjugated with a peptide consisting of 5-60 amino acids, and the complex was recovered after polucheniya.9. A complex according to claim 8, wherein the peptide contains from 10 to 50 aminokislot.10. A complex according to claim 8, wherein the antibody according to claim. A) is a monoclonal antitelom.11. . The complex of claim 8, wherein the antibody of part a) contains a heavy chain variable domain sequence with SEQ ID NO: 1 and1. Фармацевтическая композиция, содержащая комплекс:a) моноспецифического антитела,
