islets ( ) already provides imaging of molecular probes. Formula (1), (2) and (3) the probe molecule or a polypeptide comprising a polypeptide having a homology with the polypeptide represented by. Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH 2 (1) (SEQ ID NO: 1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH 2 (2) (SEQ ID NO: 2) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH 2 (3) (SEQ ID NO: 3) In the formula (1) and (2), "X" denotes a lysine residue amino groups of the side chain labeled with a radionuclide, "Z-" is either the N-terminal - amino group of a non-formula,, or, It indicates that it is qualified by the number of dishes that do not have a charge. In the formula (3), and "B-" indicate that are labeled with the N-terminal - amino group is a radionuclide. The formula (1), (2) A, and (3), "-NH 2 " is indicates that the carboxyl group of the C-terminal is amidated.췌도(膵島) 이미징용 분자 프로브의 제공. 하기 식 (1), (2) 및 (3)으로 표시되는 폴리펩티드 혹은 상기 폴리펩티드와 상동성을 가지는 폴리펩티드를 포함하는 분자 프로브. Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2(1) (서열 번호 1)Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2(2) (서열 번호 2)B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2(3) (서열 번호 3)상기 식 (1) 및 (2)에 있어서, 「X」는, 측쇄의 아미노기가 방사성 핵종으로 표지된 리신 잔기를 나타내고, 「Z-」는, N말단의 α-아미노기가 비수식이거나, 또는, 전하를 가지지 않는 수식기에 의해 수식되어 있는 것을 나타낸다. 상기 식 (3)에 있어서, 「B-」는, N말단의 α-아미노기가 방사성 핵종으로 표지되어 있는 것을 나타낸다. 상기 식 (1), (2) 및 (3)에 있어서, 「-NH2」는, C말단의 카르복시기가 아미드화되어 있는 것을 나타낸다.
