The present invention relates in particular to polyclonal antibodies directed against peptides, particularly derivatives of the propeptide of sequence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR (SEQ ID NO 1). The present invention also relates to a method for the production of the aforementioned antibodies and to a method for dosing same. In addition, the present invention relates to a method for detecting/determining depression in an individual and a method for monitoring the effectiveness of a treatment for depression.La présente invention se rapporte à notamment à des anticorps polyclonaux dirigés contre des peptides, notamment dérivés du propeptide de séquence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR (SEQ ID NO 1). La présente invention se rapporte également à un procédé de fabrication desdits anticorps, à un procédé de dosage desdits peptides. En outre, la présente invention se rapporte à un procédé de détection/détermination de la dépression chez un individu et un procédé de suivi de l'efficacité d'un traitement sur la dépression.
