The present invention is more particularly directed to the peptides of the propetide directly against sequence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR (No. 1 SEQ ID), especially derived product polyclonal antibody. The invention further relates to a kind of method of production for above-mentioned antibody and to be related to a kind of method identical for taking stimulants. In addition, the present invention relates to a kind of for detecting/determining recess and a kind of method for monitoring the method for the effectiveness of the treatment for recess in an individual.La présente invention se rapporte à notamment à des anticorps polyclonaux dirigés contre des peptides, notamment dérivés du propeptide de séquence QDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRR (SEQ ID NO 1). La présente invention se rapporte également à un procédé de fabrication desdits anticorps, à un procédé de dosage desdits peptides. En outre, la présente invention se rapporte à un procédé de détection/détermination de la dépression chez un individu et un procédé de suivi de l'efficacité d'un traitement sur la dépression.
