1. A peptide consisting of 6-20 amino acid residues and derived from the amino acid sequence VFKGTLKYGYTTAWWLGIDQSIDFEIDSAI (SEQ ID №. 23), wherein said peptide comprises the amino acid sequence WWLGID (SEQ ID №. 24) .2. Peptide according to Claim. 1, characterized in that the amino acid sequence of this peptide is selected from the group consisting of YTTAWWLGIDQS sequences (SEQ ID №. 1), YGYTTAWWLGIDQSID (SEQ ID №. 7), TTAWWLGIDQS (SEQ ID №. 8), TAWWLGIDQS ( SEQ ID №. 9), AWWLGIDQS (SEQ ID №. 10), WWLGIDQS (SEQ ID №. 11), YTTAWWLGIDQ (SEQ ID №. 13), YTTAWWLGID (SEQ ID №. 14), TTAWWLGIDQ (SEQ ID №. 18 ) and TTAWWLGID (SEQ ID №. 19) .3. Peptide according to Claim. 1, characterized in that the peptide contains a cysteine residue at its C and / or N-kontse.4. The peptide of claim. 2, characterized in that the peptide contains a cysteine residue at its C and / or N-kontse.5. A peptide according to any one of claims. 1-4 for use in the prevention and / or treatment of atherosclerosis and related diseases aterosklerozom.6. The peptide of claim. 5, characterized in that the disease associated with atherosclerosis is selected from the group consisting of peripheral arterial occlusive disease, coronary artery disease, apoplexy and insulta.7. The peptide of claim. 5, characterized in that the peptide is administered to the individual in an amount of 0.5-500 g, preferably 1-100 ug immunizatsiyu.8. The peptide of claim. 6, characterized in that the peptide is administered to the individual in an amount of 0.5-500 g, preferably 1-100 ug immunizatsiyu.9. A vaccine comprising at least one peptide according to any one of claims. 1-4.10. The vaccine of claim. 9, characterized in that at least one peptide is conjugated or associated with a pharmaceutically acceptable carrier, preferably a protein KLH (keyhole limpet hemocyanin) .11. The vaccine of claim. 9, characterized in that at least od1. Пептид, состоящий из 6-20 аминокислотных остатков и происходящий из аминокислотной посл
