599049 Disclosed is a monoclonal antibody as an antagonist for use as a medicament for preventing or treating cancer, wherein the monoclonal antibody specifically binds to the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR, KINATDADEPNTLNSKISYR or EELSAAHTLV of the non-cell adhesion recognition (CAR) sites region of the EC2 domain of Dsg2 and inhibits epithelial mesenchymal transition (EMT).