The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.본 발명은 암의 치료에서 사용하기 위한 작용제에 관한 것이다. 사용될 작용제는 Dsg2의 길항제이고, 상기 길항제는 Dsg2의 EC2 도메인의 아미노산 서열: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (서열번호 1), 또는 그의 단편 또는 그의 변이체의 기능을 조절한다. 또한, 본 발명은 특정한 폴리펩티드 및 약제학적 제제를 포함한다. 본 발명은 또한 Dsg2의 EC2 도메인의 아미노산 서열: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (서열번호 1), 또는 그의 단편 또는 변이체의 기능을 조절하는, Dsg2의 길항제를 스크리닝하는 방법을 포함한다.