The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein said antagonist modulates the function of the amino acid sequence: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.La presente invención se refiere a agentes para usarse en el tratamiento de cáncer. El agente que será utilizado es un antagonista de Dsg2, en donde dicho antagonista modula la función de la secuencia de aminoácido: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLN SKISYR (SEC ID NO: 1), o un fragmento o variante del mismo, del dominio EC2 de Dsg2. También se incluyen en la invención polipéptidos específicos y preparaciones farmacéuticas. En la invención también se incluye un método para clasificar antagonistas de Dsg2, en donde dicho antagonista modula la función de la secuencia de aminoácido: TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEC ID NO: 1),, o un fragmento o variante del mismo, del dominio EC2 de Dsg2.
