1. A peptide consisting of 7-17 adjacent amino acids and comprising a TXEXXE hexamer in which X, X, and Hmogut can be any natural or artificial amino acid, the peptide having no binding activity to the TNF receptor and is cyclized to prevent and treat increased epithelial permeability cells and endothelial cells. 2. A peptide consisting of 7-17 adjacent amino acids and comprising the TPEGAE hexamer, the peptide having no binding activity to the TNF receptor and is cyclized for the prevention and treatment of increased permeability of epithelial cells and endothelial cells. 3. A cyclized peptide consisting of a sequence of consecutive amino acids selected from the group consisting of QRETPEGAEAKPWY-PKDTPEGAELKPWY-CGQRETPEGAEAKPWYC and CGPKDTPEGAELKPWYC and fragments from at least 7 of its amino acids, the fragments including hexamer for the treatment of epithelial prophylaxis and TPEGE medicament and endothelial cells. 4. The peptide according to any one of paragraphs. 1 to 3 for the treatment of pneumonia, acute lung injury, adult respiratory distress syndrome (ADRS), or bacterial or viral pulmonary diseases, in particular Listeria monocytogenes, Streptococcus pneumoniae infections, SARS, RSV viruses or influenza viruses. 5. The peptide according to any one of paragraphs. 1 to 3, characterized in that it includes the amino acid sequence CGQRETPEGAEAKPWYC and is cyclized by C-residues. 6. The peptide according to claim 5, characterized in that it is cyclized through a disulfide bridge between the aforementioned C-residues. The peptide according to any one of paragraphs. 1 to 3, characterized in that it is used to protect e1. Пептид, состоящий из 7-17 смежных аминокислот и включающий гексамер TXEXXE, в котором X, Xи Хмогут представлять собой любую природную или искусственную аминокислоту, причем пептид не обладает активностью связывания с рецептором TNF и является циклизированным, для профилактики и лечения повышенной проницаемости эпителиальных клеток и эндотелиальны
