The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below:VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.
