The amino acid sequence of KILQQSRIVQX, wherein X is absent or S； The amino acid sequence of 10 or more consecutive amino acids in the amino acid sequence of DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (SEQ ID NO: 16)； Or a peptide comprising the amino acid sequence of QNLNHYIQVLENLVRSVPS (SEQ ID NO: 9) and consisting of 10 to 45 amino acids, or substitution, deletion or addition of 1 to 3 amino acids to have an amino acid sequence different from the amino acid sequence of the peptide Peptides with helper T cell activation ability are provided. In addition, products related to the peptide, such as polynucleotides, are provided. In addition, the use of the peptides and products as a pharmaceutical or a composition for activating helper T cells is provided.KILQQSRIVQX (여기서 X는 부재하거나 S이다)의 아미노산 서열； DVQKIVESQINFHGKKLKLGPAIRKQNLCAYHVQPRPL (서열번호: 16)의 아미노산 서열 중의 10개 이상의 연속적인 아미노산의 아미노산 서열； 또는 QNLNHYIQVLENLVRSVPS (서열번호: 9)의 아미노산 서열을 포함하고, 10개 내지 45개의 아미노산으로 이루어진 펩티드, 또는 1개 내지 3개의 아미노산의 치환, 결실 또는 부가되어 상기 펩티드의 아미노산 서열과 상이한 아미노산 서열을 갖고 헬퍼 T 세포 활성화능을 갖는 펩티드가 제공된다. 또한, 상기 펩티드에 관련된 산물, 예컨대 폴리뉴클레오티드가 제공된다. 또한, 상기 펩티드 및 산물의 의약 또는 헬퍼 T 세포 활성화를 위한 조성물로서의 용도가 제공된다.
