A reconstituted surfactant composition comprising: a) 1.2 to 1.8% by weight of a native SP-C surfactant protein polypeptide analog consisting of the sequence represented by the formula IPSSPVHLKRLKLLLLLLLLILLLILGALLLGL (SEQ ID NO: 1) ； b) 0.1 to 0.5% by weight of a native SP-B surfactant protein polypeptide analog consisting of the sequence represented by the formula CWLCRALIKRIQALIPKGGRLLPQLVCRLVLRCS (SEQ ID NO: 2)； c) a monounsaturated phospholipid and a saturated phospholipid in a weight ratio ranging from 45:55 to 55:45； wherein said monounsaturated phospholipid is selected from the group consisting of palmitoyloleylphosphatidylcholine (POFC) and palmitoylolethylphosphatidylglycerol (POFG), and wherein said saturated phospholipid is selected from the group consisting of dipalmitoylphosphatidylcholine (DPFC) and dipal phosphol (DPFC)； all amounts being calculated in relation to the total weight of the reconstituted surfactant.Una composición de tensioactivo reconstituido que comprende: a) de 1,2 a 1,8 % en peso de un análogo polipeptídico de la proteína tensioactiva SP-C nativa que consiste en la secuencia representada por la fórmula IPSSPVHLKRLKLLLLLLLLILLLILGALLLGL (SEQ ID NO: 1)； b) de 0,1 a 0,5 % en peso de un análogo polipeptídico de la proteína tensioactiva SP-B nativa que consiste en la secuencia representada por la fórmula CWLCRALIKRIQALIPKGGRLLPQLVCRLVLRCS (SEQ ID NO: 2)； c) un fosfolípido monoinsaturado y un fosfolípido saturado en una relación en peso que oscila entre 45:55 a 55:45； en el que dicho fosfolípido monoinsaturado se selecciona entre el grupo que consiste en palmitoiloleilfosfatidilcolina (POFC) y palmitoiloleilfosfatidilglicerol (POFG), y en el que dicho fosfolípido saturado se selecciona entre el grupo que consiste en dipalmitoilfosfatidilcolina (DPFC) y dipalmitoilfosfatidilglicerol (DPFG)； todas las cantidades siendo calculadas en relación con el peso total del tensioactivo reconstituido.
