Provided are a polypeptide P11 and uses thereof. The amino acid sequence of the polypeptide is: HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRGP. The polypeptide is use for: preparing a medicine or pharmaceutical composition for treating or preventing diabetes, and preparing a medicine or pharmaceutical composition for reducing weight. The polypeptide can effectively exert glucose-dependent insulinotropin secretion effect； the polypeptide can reduce blood sugar, inhibit food intake and control weight loss of STZ diabetes model mice, thus allowing same to maintain a good pancreatic islet morphology, increase the area of the pancreatic islet thereof, and increase the level of C-peptide thereof； the blood sugar reducing and body weight controlling effect of the polypeptide are obviously better than those of Exendin-4 and GLP-1； and the polypeptide is efficacious for obesity.L'invention concerne un polypeptide P11 et ses utilisations. La séquence d'acides aminés du polypeptide est : HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRGP. Le polypeptide est utilisé pour : préparer un médicament ou une composition pharmaceutique pour traiter ou prévenir le diabète, et préparer un médicament ou une composition pharmaceutique pour réduire le poids. Le polypeptide peut efficacement exercer un effet de sécrétion d'insulinotropine dépendant du glucose ； le polypeptide peut réduire la glycémie, inhiber la prise de nourriture et contrôler la perte de poids de souris modèles atteintes de diabète STZ, ce qui lui permet de maintenir une bonne morphologie des îlots pancréatiques, d'augmenter la zone de l'îlot pancréatique de celui-ci, et augmenter le niveau de C-peptide de celui-ci ； l'effet de réduction de la glycémie et de contrôle du poids corporel du polypeptide sont évidemment meilleurs que ceux de l'exendine-4 et du GLP-1 ； et le polypeptide est efficace pour l'obésité.
