598202 Disclosed is an isolated antibody or antigen-binding fragment thereof that binds to the same epitope on hAng-2 as an antibody which comprises the complementarity determining regions (CDRs) of a heavy chain variable region (HCVR) having the amino acid sequence of SEQ ID NO:18, and the CDRs of a light chain variable region (LCVR) having the amino acid of SEQ ID NO:20. Wherein SEQ ID NO:18 is: EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYDIHWVRQATGKGLEWVSAIGPAGDTYYPGSVKGRFTISRENAKNSLYLQMNSLRAGDTAVYYCARGLITFGGLIAPFDYWGQGTLVTVSS And SEQ ID NO:20 is: EIVLTQSPGTLSLSPGERATLSCRASQSVSSTYLAWYQQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQHYDNSQTFGQGTKVEIK