Patent No. 597981 Disclosed is a compound having the formula: R1-Z-R2 wherein R1 is H, C1-4 alkyl, acetyl, formyl, benzoyl or trifluoroacetyl R2 is OH or NH2 and Z is a peptide having the formula I His-X2-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-X12-Tyr-Leu-Asp-X16-X17-Ala-Ala-X20-X21-Phe- Val-X24-Trp-Leu-X27-X28-Ala-X30 (I) wherein X2 is selected from Aib and Ser X12 is selected from Lys, Arg or Leu X16 is selected from Arg and X X17 is selected from Arg and X X20 is selected from Arg, His and X X21 is selected from Asp and Glu X24 is selected from Ala and X X27 is selected from Leu and X X28 is selected from Arg and X X30 is X or is absent wherein at least one of X16, X17, X20, X24, X27, X28, and X30 is X and wherein each residue X is independently selected from the group consisting of Glu, Lys, Ser, Cys, Dbu, Dpr and Orn wherein the side chain of at least one residue X is conjugated to a lipophilic substituent having the formula: (i) Z1, wherein Z1 is a lipophilic moiety conjugated directly to the side chain of X or (ii) Z1Z2, wherein Z1 is a lipophilic moiety, Z2 is a spacer, and Z1 is conjugated to the side chain of X via Z2 with the proviso that Z is not HSQGTFTSDYSKYLDS-K(Hexadecanoyl-&gamma-Glu)-AAHDFVEWLLRA. Also disclosed are the compounds such as HSQGTFTSDYSKYLDSKAAHDFVEWLLRA HSQGTFTSDYSKYLDKKAAHDFVEWLLRA and HSQGTFTSDYSKYLDSKAAKDFVEWLLRA.
