The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as the pharmaceutical compositions thereof comprising such polypeptides and their use for making a medicine for preventing or treating skin and mucous membrane conditions involving dendritic cells or Langerhans cells.La présente invention a pour objet un polypeptide correspondant aux acides aminés 26 à 75 de la séquence de la protéine GRA5-RH de SEQ ID N°1 : MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVTGHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE ses variants actifs sur la migration des cellules dendritiques, homologues actifs sur la migration des cellules dendritiques, ainsi que leurs fragments actifs sur la migration des cellules dendritiques, ainsi que les compositions pharmaceutiques comprenant de tels polypeptides et leur utilisation pour la fabrication d'un médicament destiné à prévenir ou traiter des pathologies de la peau ou des muqueuses impliquant des cellules dendritiques ou des cellules de Langerhans.