Refers to stable variants and / or pharmacologically potent Human Fibroblast Growth Factor 21 (FGF21), Pharmaceutical compositions comprising the FGF21 variants, and Methods for treating Type 2 diabetes, obesity, dyslipidemia, metabolic syndrome, or any combination Of them, using such variants.Claim 1: A variant of Human Fibroblast Growth Factor 21 (FGF21), wherein the Amino Acid Sequence is: hpipdsspllqfggqvrqrylytddaqqtechleiredgtvgcaadqspesllqlkalkpgviqilgvktsrflcqrpdgalygslhfdpeacsfredlledgynvyqseahglplhlpgdksphrkpaprgparflplpglppalpeppgil Apqppdvgssdplrlvepsqllspsflg (SEC ID no. 1).Se refiere a variantes estables y/o farmacológicamente potentes del factor 21 de crecimiento del fibroblasto humano (FGF21), composiciones farmacéuticas que comprenden variantes del FGF21, y métodos para tratar diabetes tipo 2, obesidad, dislipidemia, o síndrome metabólico, o cualquier combinación de los mismos, usando tales variantes. Reivindicación 1: Una variante del factor 21 de crecimiento del fibroblasto humano (FGF21), caracterizado porque la secuencia de aminoácido es: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLLEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLLSPSFLG (SEC ID Nº 1).
