Patent No. 601538 Disclosed is an immunogenic composition for use in the treatment or prevention of infection or disease caused by N. meningitidis and/or Neisseria gonorrhoeae, comprising at least one modified factor H binding protein, wherein the composition is capable of eliciting an immune response, when administered to a human or non-human animal, wherein the modified factor H binding protein has at least 70% sequence identity with the sequence MPSEPPFGRHLIFASLTCLIDAVCKKRYHNQNVYILSILRMTRSKPVNRTAFCCLSLTTALILT ACSSGGGGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGN GDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSG KMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIE HLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVN GIRHIGLAAKQ, and has a changed amino acid at at least one position which results in no factor H binding, or significantly reduced factor H binding compared with the factor H binding protein of said sequence, wherein the at least one position is selected from the group comprising amino acid residue at position number 103, 106, 107, 108, 109, 145, 147, 149, 150, 154, 156, 157, 180, 181, 182, 183, 184, 185, 191, 193, 194, 195, 196, 199, 262, 264, 266, 267, 268, 272, 274, 283, 285, 286, 288, 289, 302, 304 306, 311 and 313 as defined in said sequence.
