The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.Cette invention concerne des agents destinés à être utilisés pour traiter le cancer. L'agent à utiliser selon l'invention est un antagoniste de Dsg2, ledit antagoniste modulant la fonction de la séquence d'acides aminés : TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID N° : 1), ou d'un fragment ou d'une variante de celle-ci, du domaine EC2 de Dsg2. Cette invention concerne également des polypeptides spécifiques et des préparations pharmaceutiques ainsi qu'un procédé de criblage destiné à identifier des antagonistes de Dsg2, ledit antagoniste modulant la fonction de la séquence d'acides aminés : TQDVFVGS VEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID N°: 1), ou d'un fragment ou d'une variante de celle-ci, du domaine EC2 de Dsg2.
