Die vorliegende Erfindung betrifft ein Peptid, welches aus 10 bis 30 Aminosäureresten besteht und von der Aminosäuresequenz SIPWNLERITPPRYRADEYQPPDGGSLVEV (SEQ ID Nr. 1) abgeleitet ist, wobei das Peptid die Aminosäuresequenz SIPWNLERIT umfasst, und ein Vakzin umfassend dieses Peptid.Peptide which consists of: 10-30 amino acid residues and is derived from the amino acid sequence of SEQ ID No. 1 (comprising a fully defined 30 amino acid sequence given in the specification) and an amino acid sequence, is new. Peptide which consists of: 10-30 amino acid residues and is derived from the amino acid sequence of SEQ ID No. 1 (comprising a fully defined 30 amino acid sequence given in the specification) and an amino acid sequence of Ser-Ile-Pro-Trp-Asn-Leu-Glu-Arg-Ile-Thr, is new. An independent claim is included for a vaccine comprising the peptide. ACTIVITY : Cardiovascular-Gen. Cerebroprotective Vasotropic. MECHANISM OF ACTION : Vaccine Proprotein convertase subtilisin/kexin type 9-low density lipoprotein receptor interaction inhibitor. Tests details are described but no results given.
