Patent No. 595361 Disclosed is a non-naturally occurring fHbp, comprising, from N-terminus to C-terminus: VA-I3-VB-I4-VC-I5-VD-I6-VE, wherein the combination of alleles for each of VA, VB, VC, VD, and VE variable segments is not found in Table 7, wherein each of the variable segments is either alpha (a) progenitor sequence or a beta (b) progenitor sequence such as VAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRDFDIRQLEVDGQLITLESGEFQVYKQSHSALTALQTEQVQDSEDSGKMVAKRQFRIGDIAGEHTSFDKLPKGGSATYRGTAFGSDDAGGKLTYTIDFAAKQGHGKIEHLKSPELNVDLAAAYIKPDEKHH AVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAA.