Provided in the present invention is a GLP-1 derivate DLG3312 with the structure X-Y-X, wherein the sequence represented by X is H-X8-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG, X8 is any one of A、G、dA or V, and Y represents diaminocarboxylic acid comprising Lys and Om. Also provided in the present invention are the solid-phase chemical synthesis method of the GLP-1 derivate DLG3312 and the use thereof in preparing a drug for treatment of diabetes.La présente invention concerne un dérivé DLG3312 de GLP-1 ayant la structure X-Y-X, la séquence représentée par X est H-X8-EGTFTSDVSSYLEGQAAKEFIAWLVKGRG, X8 est lun quelconque de A, G, dA ou V, et Y représente un acide diaminocarboxylique comprenant Lys et Om. La présente invention concerne également un procédé de synthèse chimique en phase solide du dérivé DLG3312 de GLP-1 et lutilisation de celui-ci pour la préparation dun médicament pour le traitement du diabète.
