The present invention provides an active peptide derived from scorpions, and derivatives, analogues, and active fragments thereof. The peptide is obtained from scorpions through extraction, separation, and purification, and has an amino acid sequence of VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCYKLPDDARIMKPGRCNGG. The present invention further provides a use of the peptide in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.Linvention concerne un peptide actif provenant du scorpion, ainsi que des dérivés, des analogues et des fragments actifs de celui-ci. Le peptide selon linvention est obtenu dun scorpion par extraction, séparation et purification, et il contient une séquence dacides aminés de VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCYKLPDDARIMKPGRCNGG. Linvention concerne également lutilisation de ce peptide dans la préparation dun médicament analgésique, le peptide étant mélangé à un excipient pharmaceutiquement acceptable pour préparer des formes destinées à être injectées, administrées par voie orale, absorbées par voie cutanée et par voie muqueuse.
