Patent No. 595644 Disclosed is an in vitro method of inducing apoptosis in a target cell comprising the steps: a. providing one or more target cells displaying the cell surface antigen, ICAM-1； b. providing one or more human or humanised antibodies which selectively binds to cell surface ICAM-1 and, on binding ICAM-1, induces apoptosis of the target cell, provided the variable regions of the antibody are not the variable regions shown in the sequences of QSVLTQPPSASGTPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYDNNNRPSGVPDRFSGSKSGTSASLAI SGLRSEDEADYYCQSYDSSLSAWLFGGGTKLTVLG； c. exposing the target cells of (a) to the antibodies of (b) to induce apoptosis in the target cells. Also disclosed is a human or humanised antibody molecule which selectively binds to cell surface ICAM-1 and, on binding ICAM-1, induces apoptosis of the target cell, provided the variable regions of the antibody are not the variable regions shown in the sequences of QSVLTQPPSASGTPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYDNNNRPSGVPDRFSGSKSGTSASLAI SGLRSEDEADYYCQSYDSSLSAWLFGGGTKLTVLG.
