<; p >; The Invention relates to a Peptide product that includes the sequence of amino acids ltlrkepaseiaqsileaysqngwanrrsggkpr,The Aminoacid sequence of amino acids that are D - Aminoacid residues, and to methods for using this Peptide product in the treatment of age-related disorders. <; / p >;LA PRESENTE INVENCIÓN SE REFIERE A PÉPTIDOS QUE COMPRENDEN LA SECUENCIA DE AMINOÁCIDOS LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, DONDE DICHOS AMINOÁCIDOS DE DICHA SECUENCIA SON RESIDUOS D-AMINOÁCIDOS, Y LOS MÉTODOS DE USO DE ESTOS AMINOÁCIDOS EN EL TRATAMIENTO DE DESORDENES RELACIONADOS CON LA EDAD.