PROBLEM TO BE SOLVED: To provide a peptide-containing pharmaceutical composition for the treatment of viral diseases.SOLUTION: A therapeutic composition for the treatment of viral diseases caused by infections with herpes simplex viruses has at least 95% sequence identity to an amino acid sequence NH-VCVLAHHFGKEFTPPVQAAYQKWAGVANALAHKYH-COOH, and contains peptides having inhibitory activity to the herpes simplex viruses. The formulations are formulated for infusions, as ointments, tablets, sprays, capsules and similar preparations, or in combination with other antiviral therapeutic agents.