The invention concerns a polypeptide corresponding to amino acids 26 to 75 of the sequence of GRA5-RH protein of SEQ ID No 1: MASVKRVWAVMIVNVLALIFVGVAGSTRDVGSGGDDSEGARGRE QQQVQQHEQNEDRSLFERGRAAVT-GHPVRTAVGLAAAWAWSLL RLLKRRRRRAIQEESKESATAEEEEVAEEE, its variants acting on dendritic cell migration, homologues acting on dendritic cell migration, and fragments thereof acting on dendritic cell migration, as well as the pharmaceutical compositions thereof comprising such polypeptides and their use for making a medicine for preventing or treating skin and mucous membrane conditions involving dendritic cells or Langerhans cells.